PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G063400.1.p
Common NameSb08g005290, SORBIDRAFT_08g005290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 253aa    MW: 28116.6 Da    PI: 11.0919
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G063400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-161156147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          rg W + Ed++l ++v ++G+ +W++Ia+ +  gR++k+c++rw++ 
  Sobic.008G063400.1.p 11 RGHWRPGEDDKLRQLVDKYGPQNWNSIAENLE-GRSGKSCRLRWFNQ 56
                          899*****************************.***********996 PP

2Myb_DNA-binding54.13.7e-1763106146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           r ++T+ E+ell++a++ +G++ W++I+r ++ gRt++ +k++w+ 
  Sobic.008G063400.1.p  63 RRPFTAAEEELLLQAHRAHGNR-WALISRFFP-GRTDNAVKNHWHV 106
                           679*******************.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.579657IPR017930Myb domain
SuperFamilySSF466891.31E-299104IPR009057Homeodomain-like
SMARTSM007172.4E-131059IPR001005SANT/Myb domain
PfamPF002494.8E-161156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-251264IPR009057Homeodomain-like
CDDcd001672.64E-131455No hitNo description
PROSITE profilePS5129424.20458112IPR017930Myb domain
SMARTSM007173.1E-1562110IPR001005SANT/Myb domain
PfamPF002491.2E-1463106IPR001005SANT/Myb domain
CDDcd001674.40E-1365105No hitNo description
Gene3DG3DSA:1.10.10.604.3E-2065110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MEKSSRVRPS RGHWRPGEDD KLRQLVDKYG PQNWNSIAEN LEGRSGKSCR LRWFNQLDPR  60
INRRPFTAAE EELLLQAHRA HGNRWALISR FFPGRTDNAV KNHWHVVTAR RRRGHHHHHR  120
TLVGDGEQTA TSTGYVAVVP PRHQPPFHHQ YFHFGSCCLP ATTTKMTTTR SLCFAVPAGS  180
GPLGLSSSRA GTYGVVRNCN VPTAAAAVAL LDGHRRHDMS KDHGRRGGDD GGAGAVANRK  240
DVQFFDFLGV GI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30111117107B-MYB
1gv2_A8e-31111114104MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-31111114104C-Myb DNA-Binding Domain
1msf_C8e-31111114104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9724981e-143EU972498.1 Zea mays clone 382267 myb-like DNA-binding domain containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441942.10.0hypothetical protein SORBIDRAFT_08g005290
TrEMBLC5YT870.0C5YT87_SORBI; Putative uncharacterized protein Sb08g005290
STRINGSb08g005290.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-57myb domain protein 52